RASGRF1 Antikörper (N-Term)

Produktnummer ABIN634389

Produktdetails anti-RASGRF1 Antikörper

Target: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASGRF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RASGRF1 antibody was raised against the N terminal of RASGRF1

Aufreinigung: Affinity purified

Immunogen: RASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASGRF1 Blocking Peptide, catalog no. 33R-7877, is also available for use as a blocking control in assays to test for specificity of this RASGRF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASGRF1

Target: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Andere Bezeichnung: RASGRF1 (RASGRF1 Produkte)

Synonyme: CDC25 antikoerper, CDC25L antikoerper, GNRP antikoerper, GRF1 antikoerper, GRF55 antikoerper, H-GRF55 antikoerper, PP13187 antikoerper, ras-GRF1 antikoerper, AI844718 antikoerper, CDC25Mm antikoerper, Grf1 antikoerper, Grfbeta antikoerper, P190-A antikoerper, Ras-GRF1 antikoerper, p190 antikoerper, p190RhoGEF antikoerper, cdc25 antikoerper, rasgrf1 antikoerper, Ras protein specific guanine nucleotide releasing factor 1 antikoerper, RAS protein-specific guanine nucleotide-releasing factor 1 antikoerper, Ras protein specific guanine nucleotide releasing factor 1 S homeolog antikoerper, si:ch211-234p18.3 antikoerper, RASGRF1 antikoerper, Rasgrf1 antikoerper, rasgrf1.S antikoerper, si:ch211-234p18.3 antikoerper, rasgrf1 antikoerper

Hintergrund: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: RTK Signalweg, Zellzyklus, M Phase