RASGRF1 Antikörper (N-Term)

Produktnummer ABIN634389

Der Kaninchen Polyklonal anti-RASGRF1 Antikörper (ABIN634389) detektiert spezifisch RASGRF1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für RASGRF1 Antikörper (N-Term) (ABIN634389)

Target: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASGRF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RASGRF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RASGRF1 antibody was raised against the N terminal of RASGRF1

Aufreinigung: Affinity purified

Immunogen: RASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASGRF1 Blocking Peptide, (ABIN5615767), is also available for use as a blocking control in assays to test for specificity of this RASGRF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASGRF1

Target: RASGRF1 (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1))

Andere Bezeichnung: RASGRF1

Hintergrund: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: RTK Signalweg, Zellzyklus, M Phase