JAK3 Antikörper

Produktnummer ABIN634320

Der Kaninchen Polyklonal anti-JAK3 Antikörper (ABIN634320) detektiert spezifisch JAK3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für JAK3 Antikörper (ABIN634320)

Target: JAK3 (Janus Kinase 3 (JAK3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JAK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-JAK3 Antikörper

Aufreinigung: Affinity purified

Immunogen: JAK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JAK3 Blocking Peptide, (ABIN939905), is also available for use as a blocking control in assays to test for specificity of this JAK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu JAK3

Target: JAK3 (Janus Kinase 3 (JAK3))

Andere Bezeichnung: JAK3

Hintergrund: JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).

Molekulargewicht: 125 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, RTK Signalweg, Response to Growth Hormone Stimulus, Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus, Activated T Cell Proliferation, Unfolded Protein Response