EGF Antikörper
-
- Target Alle EGF Antikörper anzeigen
- EGF (Epidermal Growth Factor (EGF))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EGF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- EGF antibody was raised using a synthetic peptide corresponding to a region with amino acids ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
- Top Product
- Discover our top product EGF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EGF Blocking Peptide, catalog no. 33R-4179, is also available for use as a blocking control in assays to test for specificity of this EGF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EGF (Epidermal Growth Factor (EGF))
- Andere Bezeichnung
- EGF (EGF Produkte)
- Synonyme
- HOMG4 antikoerper, URG antikoerper, AI790464 antikoerper, CEGF antikoerper, epidermal growth factor antikoerper, pro-epidermal growth factor antikoerper, EGF antikoerper, egf antikoerper, CpipJ_CPIJ020278 antikoerper, Egf antikoerper
- Hintergrund
- Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin.
- Molekulargewicht
- 6 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation
-