EGF Antikörper

Produktnummer ABIN634270

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EGF in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für EGF Antikörper (ABIN634270)

Target: EGF (Epidermal Growth Factor (EGF))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EGF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EGF Antikörper

Aufreinigung: Affinity purified

Immunogen: EGF antibody was raised using a synthetic peptide corresponding to a region with amino acids ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EGF Blocking Peptide, (ABIN939565), is also available for use as a blocking control in assays to test for specificity of this EGF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EGF

Target: EGF (Epidermal Growth Factor (EGF))

Andere Bezeichnung: EGF

Hintergrund: Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin.

Molekulargewicht: 6 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation