IL1A Antikörper (N-Term)
-
- Target Alle IL1A Antikörper anzeigen
- IL1A (Interleukin 1 alpha (IL1A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL1 alpha antibody was raised against the N terminal of IL1 A
- Aufreinigung
- Affinity purified
- Immunogen
- IL1 alpha antibody was raised using the N terminal of IL1 A corresponding to a region with amino acids VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS
- Top Product
- Discover our top product IL1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL1 alpha Blocking Peptide, catalog no. 33R-9834, is also available for use as a blocking control in assays to test for specificity of this IL1 alpha antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL1A (Interleukin 1 alpha (IL1A))
- Andere Bezeichnung
- IL1 alpha (IL1A Produkte)
- Synonyme
- IL-1A antikoerper, IL1 antikoerper, IL1-ALPHA antikoerper, IL1F1 antikoerper, IL-6 antikoerper, Il-1a antikoerper, IL-1 alpha antikoerper, IL-1alpha antikoerper, L1A antikoerper, interleukin 1 alpha antikoerper, interleukin 6 antikoerper, IL1A antikoerper, IL6 antikoerper, Il1a antikoerper
- Hintergrund
- The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis.
- Molekulargewicht
- 18 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, Autophagie, Cancer Immune Checkpoints
-