IL1A Antikörper (N-Term)

Produktnummer ABIN634266

Dieses Anti-IL1A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IL1A in WB. Geeignet für Human.

Kurzübersicht für IL1A Antikörper (N-Term) (ABIN634266)

Target: IL1A (Interleukin 1 alpha (IL1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL1A Antikörper

Bindungsspezifität: N-Term

Spezifität: IL1 alpha antibody was raised against the N terminal of IL1 A

Aufreinigung: Affinity purified

Immunogen: IL1 alpha antibody was raised using the N terminal of IL1 A corresponding to a region with amino acids VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL1 alpha Blocking Peptide, (ABIN5614165), is also available for use as a blocking control in assays to test for specificity of this IL1 alpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL1A

Target: IL1A (Interleukin 1 alpha (IL1A))

Andere Bezeichnung: IL1 alpha

Hintergrund: The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, Autophagie, Cancer Immune Checkpoints