K-RAS Antikörper (N-Term)

Produktnummer ABIN634246

Produktdetails anti-K-RAS Antikörper

Target: K-RAS (KRAS) (GTPase Kras (KRAS))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser K-RAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KRAS antibody was raised against the N terminal of KRAS

Aufreinigung: Affinity purified

Immunogen: KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KRAS Blocking Peptide, catalog no. 33R-9058, is also available for use as a blocking control in assays to test for specificity of this KRAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu K-RAS

Target: K-RAS (KRAS) (GTPase Kras (KRAS))

Andere Bezeichnung: KRAS (KRAS Produkte)

Synonyme: wu:fa04e08 antikoerper, wu:fc14b12 antikoerper, wu:fc23g10 antikoerper, wu:fj89d12 antikoerper, zgc:85725 antikoerper, Kras2 antikoerper, c-Ki-ras antikoerper, p21 antikoerper, C-K-RAS antikoerper, CFC2 antikoerper, K-RAS2A antikoerper, K-RAS2B antikoerper, K-RAS4A antikoerper, K-RAS4B antikoerper, KI-RAS antikoerper, KRAS1 antikoerper, KRAS2 antikoerper, NS antikoerper, NS3 antikoerper, RASK2 antikoerper, AI929937 antikoerper, K-ras antikoerper, Ki-ras antikoerper, Kras-2 antikoerper, p21B antikoerper, ras antikoerper, k-ras antikoerper, kras antikoerper, kras-a antikoerper, kras-b antikoerper, rask2 antikoerper, K-RAS antikoerper, p21ras antikoerper, KRAS proto-oncogene, GTPase antikoerper, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog antikoerper, Kirsten rat sarcoma viral oncogene homolog antikoerper, semicolonial-7 antikoerper, Ras family protein antikoerper, GTPase KRas antikoerper, Kirsten rat sarcoma viral oncogene homolog S homeolog antikoerper, KRAS antikoerper, kras antikoerper, Kras antikoerper, smco-7 antikoerper, PGTG_03066 antikoerper, Tsp_02666 antikoerper, Tsp_01642 antikoerper, rask antikoerper, kras.S antikoerper

Substanzklasse: Viral Protein

Hintergrund: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Molekulargewicht: 22 kDa (MW of target protein)