Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

CDK1 Antikörper (Middle Region)

CDK1 Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN634188
  • Target Alle CDK1 Antikörper anzeigen
    CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
    Bindungsspezifität
    • 35
    • 29
    • 25
    • 24
    • 18
    • 16
    • 13
    • 9
    • 8
    • 8
    • 8
    • 7
    • 6
    • 6
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reaktivität
    • 314
    • 178
    • 113
    • 37
    • 35
    • 31
    • 25
    • 20
    • 15
    • 12
    • 12
    • 11
    • 11
    • 9
    • 7
    • 6
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis
    Wirt
    • 261
    • 63
    Kaninchen
    Klonalität
    • 251
    • 73
    Polyklonal
    Konjugat
    • 159
    • 27
    • 17
    • 15
    • 11
    • 10
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Dieser CDK1 Antikörper ist unkonjugiert
    Applikation
    • 258
    • 122
    • 66
    • 59
    • 54
    • 53
    • 52
    • 43
    • 42
    • 20
    • 20
    • 16
    • 6
    • 6
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Spezifität
    CDC2 antibody was raised against the middle region of CDC2
    Aufreinigung
    Affinity purified
    Immunogen
    CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
    Top Product
    Discover our top product CDK1 Primärantikörper
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    CDC2 Blocking Peptide, catalog no. 33R-1643, is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
    Andere Bezeichnung
    CDC2 (CDK1 Produkte)
    Synonyme
    CDC2 antikoerper, CDC28A antikoerper, P34CDC2 antikoerper, Cdc2 antikoerper, Cdc2a antikoerper, p34 antikoerper, cdc2 antikoerper, wu:fc30e01 antikoerper, zgc:92032 antikoerper, PSTAIR antikoerper, cdc-2 antikoerper, cdc2-a antikoerper, cdc28a antikoerper, cdc2x1.1 antikoerper, p34cdc2 antikoerper, xcdc2 antikoerper, 5363 antikoerper, CDCDm antikoerper, CDK1 antikoerper, CDK1/CDC2 antikoerper, CG5363 antikoerper, Cdk-1 antikoerper, Cdk1 antikoerper, Dcdc2 antikoerper, Dm cdc2 antikoerper, DmCdc2 antikoerper, DmCdk1 antikoerper, Dmcdc2 antikoerper, Dmel\\CG5363 antikoerper, cdc antikoerper, cdc2Dm antikoerper, cdk1 antikoerper, dCdk1 antikoerper, group 4 antikoerper, l(2)31Eh antikoerper, CDC2A antikoerper, CDC2AAT antikoerper, CDK2 antikoerper, CDKA1 antikoerper, CDKA;1 antikoerper, CYCLIN-DEPENDENT KINASE A;1 antikoerper, cell division control 2 antikoerper, cdc2-b antikoerper, cdc2a antikoerper, cdc2x1.2 antikoerper, POL3 antikoerper, pold antikoerper, cyclin dependent kinase 1 antikoerper, cyclin dependent kinase like 1 antikoerper, Cell division control protein 2 1 antikoerper, cyclin-dependent kinase 1 antikoerper, cyclin-dependent kinase 1 S homeolog antikoerper, Cyclin-dependent kinase 1 antikoerper, cell division control 2 antikoerper, cell division control protein2 homolog antikoerper, cyclin-dependent kinase 1 L homeolog antikoerper, polymerase (DNA directed), delta 1, catalytic subunit L homeolog antikoerper, cyclin-dependent protein kinase Cdk1/Cdc2 antikoerper, CDK1 antikoerper, CDKL1 antikoerper, POPTR_0004s14080g antikoerper, Cdk1 antikoerper, cdk1 antikoerper, cdk1.S antikoerper, CDC2 antikoerper, cdc2 antikoerper, cdk-1 antikoerper, cdk1.L antikoerper, pold1.L antikoerper
    Hintergrund
    The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
    Molekulargewicht
    34 kDa (MW of target protein)
    Pathways
    Zellzyklus, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA
Sie sind hier:
Kundenservice