CDK1 Antikörper (Middle Region)
-
- Target Alle CDK1 Antikörper anzeigen
- CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDC2 antibody was raised against the middle region of CDC2
- Aufreinigung
- Affinity purified
- Immunogen
- CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
- Top Product
- Discover our top product CDK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDC2 Blocking Peptide, catalog no. 33R-1643, is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
- Andere Bezeichnung
- CDC2 (CDK1 Produkte)
- Synonyme
-
CDC2 antikoerper, CDC28A antikoerper, P34CDC2 antikoerper, Cdc2 antikoerper, Cdc2a antikoerper, p34
antikoerper, cdc2 antikoerper, wu:fc30e01 antikoerper, zgc:92032 antikoerper, PSTAIR antikoerper, cdc-2 antikoerper, cdc2-a antikoerper, cdc28a antikoerper, cdc2x1.1 antikoerper, p34cdc2 antikoerper, xcdc2 antikoerper, 5363 antikoerper, CDCDm antikoerper, CDK1 antikoerper, CDK1/CDC2 antikoerper, CG5363 antikoerper, Cdk-1 antikoerper, Cdk1 antikoerper, Dcdc2 antikoerper, Dm cdc2 antikoerper, DmCdc2 antikoerper, DmCdk1 antikoerper, Dmcdc2 antikoerper, Dmel\\CG5363 antikoerper, cdc antikoerper, cdc2Dm antikoerper, cdk1 antikoerper, dCdk1 antikoerper, group 4 antikoerper, l(2)31Eh antikoerper, CDC2A antikoerper, CDC2AAT antikoerper, CDK2 antikoerper, CDKA1 antikoerper, CDKA;1 antikoerper, CYCLIN-DEPENDENT KINASE A;1 antikoerper, cell division control 2 antikoerper, cdc2-b antikoerper, cdc2a antikoerper, cdc2x1.2 antikoerper, POL3 antikoerper, pold antikoerper, cyclin dependent kinase 1 antikoerper, cyclin dependent kinase like 1 antikoerper, Cell division control protein 2 1 antikoerper, cyclin-dependent kinase 1 antikoerper, cyclin-dependent kinase 1 S homeolog antikoerper, Cyclin-dependent kinase 1 antikoerper, cell division control 2 antikoerper, cell division control protein2 homolog antikoerper, cyclin-dependent kinase 1 L homeolog antikoerper, polymerase (DNA directed), delta 1, catalytic subunit L homeolog antikoerper, cyclin-dependent protein kinase Cdk1/Cdc2 antikoerper, CDK1 antikoerper, CDKL1 antikoerper, POPTR_0004s14080g antikoerper, Cdk1 antikoerper, cdk1 antikoerper, cdk1.S antikoerper, CDC2 antikoerper, cdc2 antikoerper, cdk-1 antikoerper, cdk1.L antikoerper, pold1.L antikoerper - Hintergrund
- The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Zellzyklus, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA
-