CDK1 Antikörper (Middle Region)

Produktnummer ABIN634188

Dieses Anti-CDK1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CDK1 in WB. Geeignet für Human, Maus, Ratte, Drosophila melanogaster und Arabidopsis.

Kurzübersicht für CDK1 Antikörper (Middle Region) (ABIN634188)

Target: CDK1 (Cyclin-Dependent Kinase 1 (CDK1))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDK1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CDC2 antibody was raised against the middle region of CDC2

Aufreinigung: Affinity purified

Immunogen: CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC2 Blocking Peptide, (ABIN937029), is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDK1

Target: CDK1 (Cyclin-Dependent Kinase 1 (CDK1))

Andere Bezeichnung: CDC2

Hintergrund: The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Zellzyklus, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA