Tec Protein Tyrosine Kinase (TEC) (Middle Region) Antikörper

Produktnummer ABIN633042

Der Kaninchen Polyklonal anti-Tec Protein Tyrosine Kinase Antikörper (ABIN633042) detektiert spezifisch Tec Protein Tyrosine Kinase in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Tec Protein Tyrosine Kinase (TEC) (Middle Region) Antikörper (ABIN633042)

Target: Tec Protein Tyrosine Kinase (TEC)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: TEC antibody was raised against the middle region of TEC

Aufreinigung: Affinity purified

Immunogen: TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TEC Blocking Peptide, (ABIN5616549), is also available for use as a blocking control in assays to test for specificity of this TEC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Tec Protein Tyrosine Kinase (TEC)

Andere Bezeichnung: TEC

Hintergrund: The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung