LDHB Antikörper (C-Term)

Produktnummer ABIN632307

Dieses Anti-LDHB-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LDHB in WB. Geeignet für Human.

Kurzübersicht für LDHB Antikörper (C-Term) (ABIN632307)

Target: LDHB (Lactate Dehydrogenase B (LDHB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LDHB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LDHB Antikörper

Bindungsspezifität: C-Term

Spezifität: LDHB antibody was raised against the C terminal of LDHB

Aufreinigung: Affinity purified

Immunogen: LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LDHB Blocking Peptide, (ABIN5614434), is also available for use as a blocking control in assays to test for specificity of this LDHB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LDHB

Target: LDHB (Lactate Dehydrogenase B (LDHB))

Andere Bezeichnung: LDHB

Hintergrund: LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Warburg Effekt