LDHB Antikörper (C-Term)
Kurzübersicht für LDHB Antikörper (C-Term) (ABIN632307)
Target
Alle LDHB Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- LDHB antibody was raised against the C terminal of LDHB
-
Aufreinigung
- Affinity purified
-
Immunogen
- LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
LDHB Blocking Peptide, (ABIN5614434), is also available for use as a blocking control in assays to test for specificity of this LDHB antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHB antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- LDHB (Lactate Dehydrogenase B (LDHB))
-
Andere Bezeichnung
- LDHB
-
Hintergrund
- LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.
-
Molekulargewicht
- 37 kDa (MW of target protein)
-
Pathways
- Warburg Effekt
Target
-