PRAS40 Antikörper

Produktnummer ABIN631641

Produktdetails anti-PRAS40 Antikörper

Target: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRAS40 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AKT1 S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKT1S1 Blocking Peptide, catalog no. 33R-4654, is also available for use as a blocking control in assays to test for specificity of this AKT1S1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRAS40

Target: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Andere Bezeichnung: AKT1S1 (AKT1S1 Produkte)

Synonyme: MGC81452 antikoerper, lobe antikoerper, pras40 antikoerper, fb34a04 antikoerper, wu:fb34a04 antikoerper, Lobe antikoerper, PRAS40 antikoerper, 1110012J22Rik antikoerper, AI227026 antikoerper, Lobel antikoerper, AKT1 substrate 1 (proline rich) S homeolog antikoerper, AKT1 substrate 1 antikoerper, AKT1 substrate 1 (proline rich) antikoerper, AKT1 substrate 1 (proline-rich) antikoerper, akt1s1.S antikoerper, AKT1S1 antikoerper, akt1s1 antikoerper, Akt1s1 antikoerper

Hintergrund: AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Cell Size, Autophagie, BCR Signaling, Warburg Effekt