PRAS40 Antikörper
-
- Target Alle PRAS40 (AKT1S1) Antikörper anzeigen
- PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRAS40 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AKT1 S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE
- Top Product
- Discover our top product AKT1S1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AKT1S1 Blocking Peptide, catalog no. 33R-4654, is also available for use as a blocking control in assays to test for specificity of this AKT1S1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKT0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))
- Andere Bezeichnung
- AKT1S1 (AKT1S1 Produkte)
- Hintergrund
- AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Cell Size, Autophagie, BCR Signaling, Warburg Effekt
-