MAP1LC3A Antikörper (N-Term)

Produktnummer ABIN631468

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MAP1LC3A in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für MAP1LC3A Antikörper (N-Term) (ABIN631468)

Target: MAP1LC3A (Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP1LC3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAP1LC3A Antikörper

Bindungsspezifität: N-Term

Spezifität: MAP1 LC1 antibody was raised against the N terminal of MAP1 C1

Aufreinigung: Affinity purified

Immunogen: MAP1 LC1 antibody was raised using the N terminal of MAP1 C1 corresponding to a region with amino acids MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP1LC3A Blocking Peptide, (ABIN5614647), is also available for use as a blocking control in assays to test for specificity of this MAP1LC3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 C0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP1LC3A

Target: MAP1LC3A (Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A))

Andere Bezeichnung: MAP1LC3A

Hintergrund: MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B.MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Autophagie