ACTR2 Antikörper

Produktnummer ABIN631175

Produktdetails anti-ACTR2 Antikörper

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTR2 Blocking Peptide, catalog no. 33R-7879, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTR2

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Andere Bezeichnung: ACTR2 (ACTR2 Produkte)

Hintergrund: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. The specific function of this gene has not yet been determined.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: RTK Signalweg, Regulation of Actin Filament Polymerization