ACTR2 Antikörper

Produktnummer ABIN629770

Produktdetails anti-ACTR2 Antikörper

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTR2 Blocking Peptide, catalog no. 33R-6704, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTR2

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Andere Bezeichnung: ACTR2 (ACTR2 Produkte)

Synonyme: ARP2 antikoerper, 4921510D23Rik antikoerper, AA409782 antikoerper, Arp2 antikoerper, D6Ertd746e antikoerper, actr2 antikoerper, hm:zeh1257 antikoerper, zgc:63719 antikoerper, actr2-B antikoerper, arp2-B antikoerper, arp2 antikoerper, ACTR2 antikoerper, DKFZp459N093 antikoerper, ACTIN RELATED PROTEIN 2 antikoerper, ATARP2 antikoerper, WRM antikoerper, WURM antikoerper, actin related protein 2 antikoerper, actr2-A antikoerper, arp2-A antikoerper, zgc:110550 antikoerper, ARP2 actin related protein 2 homolog antikoerper, ARP2 actin-related protein 2 antikoerper, ARP2 actin related protein 2a homolog antikoerper, ARP2 actin-related protein 2 homolog L homeolog antikoerper, ARP2 actin-related protein 2 homolog antikoerper, actin-related protein Arp2 antikoerper, actin related protein 2 antikoerper, ARP2 actin-related protein 2 homolog S homeolog antikoerper, ARP2 actin related protein 2b homolog antikoerper, ARP2/3 actin-organizing complex subunit Arp2 antikoerper, ACTR2 antikoerper, Actr2 antikoerper, actr2a antikoerper, actr2.L antikoerper, actr2 antikoerper, arp2 antikoerper, ARP2 antikoerper, actr2.S antikoerper, actr2b antikoerper

Hintergrund: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: RTK Signalweg, Regulation of Actin Filament Polymerization