Tyrosinase-Related Protein 1 Antikörper (N-Term)

Produktnummer ABIN630432

Dieses Anti-Tyrosinase-Related Protein 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Tyrosinase-Related Protein 1 in WB. Geeignet für Human, Maus und Hund.

Kurzübersicht für Tyrosinase-Related Protein 1 Antikörper (N-Term) (ABIN630432)

Target: Tyrosinase-Related Protein 1 (TYRP1)

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tyrosinase-Related Protein 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tyrosinase-Related Protein 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: TYRP1 antibody was raised against the N terminal of TYRP1

Aufreinigung: Purified

Immunogen: TYRP1 antibody was raised using the N terminal of TYRP1 corresponding to a region with amino acids AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TYRP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYRP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tyrosinase-Related Protein 1

Target: Tyrosinase-Related Protein 1 (TYRP1)

Andere Bezeichnung: TYRP1

Hintergrund: TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.

Molekulargewicht: 59 kDa (MW of target protein)