Tyrosinase-Related Protein 1 Antikörper (Middle Region)

Produktnummer ABIN635947

Produktdetails anti-Tyrosinase-Related Protein 1 Antikörper

Target: Tyrosinase-Related Protein 1 (TYRP1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tyrosinase-Related Protein 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TYRP1 antibody was raised against the middle region of TYRP1

Aufreinigung: Affinity purified

Immunogen: TYRP1 antibody was raised using the middle region of TYRP1 corresponding to a region with amino acids NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TYRP1 Blocking Peptide, catalog no. 33R-6659, is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYRP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tyrosinase-Related Protein 1

Target: Tyrosinase-Related Protein 1 (TYRP1)

Andere Bezeichnung: TYRP1 (TYRP1 Produkte)

Synonyme: CAS2 antikoerper, CATB antikoerper, GP75 antikoerper, OCA3 antikoerper, TRP antikoerper, TRP1 antikoerper, TYRP antikoerper, b-PROTEIN antikoerper, LOC397853 antikoerper, Trypsin antikoerper, hm:zeh0659 antikoerper, tyrp1 antikoerper, zgc:100893 antikoerper, B antikoerper, TYRP1 antikoerper, tyrp-1 antikoerper, TRP-1 antikoerper, Tyrp antikoerper, b antikoerper, brown antikoerper, isa antikoerper, tyrosinase related protein 1 antikoerper, protease, serine 1 L homeolog antikoerper, tyrosinase-related protein 1b antikoerper, tyrosinase-related protein 1 antikoerper, tyrosinase-related protein 1 L homeolog antikoerper, tyrosinase-related protein 1a antikoerper, TYRP1 antikoerper, prss1.L antikoerper, tyrp1b antikoerper, Tyrp1 antikoerper, tyrp1.L antikoerper, tyrp1 antikoerper, LOC100136490 antikoerper, tyrp-1 antikoerper, tyrp1a antikoerper

Hintergrund: TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.

Molekulargewicht: 61 kDa (MW of target protein)