DHODH Antikörper (N-Term)

Produktnummer ABIN630322

Produktdetails anti-DHODH Antikörper

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHODH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DHODH antibody was raised against the N terminal of DHODH

Aufreinigung: Purified

Immunogen: DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHODH Blocking Peptide, catalog no. 33R-2902, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Andere Bezeichnung: DHODH (DHODH Produkte)

Hintergrund: DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus