Glucagon Antikörper (N-Term)

Produktnummer ABIN630283

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Glucagon in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte, Maus und Hund.

Kurzübersicht für Glucagon Antikörper (N-Term) (ABIN630283)

Target: Glucagon (GCG)

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glucagon Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Glucagon Antikörper

Bindungsspezifität: N-Term

Spezifität: Glucagon antibody was raised against the N terminal of GCG

Aufreinigung: Purified

Immunogen: Glucagon antibody was raised using the N terminal of GCG corresponding to a region with amino acids LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Glucagon Blocking Peptide, (ABIN5613789), is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glucagon

Target: Glucagon (GCG)

Andere Bezeichnung: Glucagon

Hintergrund: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling