KCNAB2 Antikörper (Middle Region)
-
- Target Alle KCNAB2 Antikörper anzeigen
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Ratte, Human, Maus, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNAB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- KCNAB2 antibody was raised against the middle region of KCNAB2
- Aufreinigung
- Purified
- Immunogen
- KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
- Top Product
- Discover our top product KCNAB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNAB2 Blocking Peptide, catalog no. 33R-9950, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
- Andere Bezeichnung
- KCNAB2 (KCNAB2 Produkte)
- Hintergrund
- This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Molekulargewicht
- 40 kDa (MW of target protein)
-