KCNAB2 Antikörper (C-Term)

Produktnummer ABIN630079

Produktdetails anti-KCNAB2 Antikörper

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Bindungsspezifität: C-Term

Reaktivität: Ratte, Human, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNAB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNAB2 antibody was raised against the C terminal of KCNAB2

Aufreinigung: Purified

Immunogen: KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNAB2 Blocking Peptide, catalog no. 33R-4735, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNAB2

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Andere Bezeichnung: KCNAB2 (KCNAB2 Produkte)

Synonyme: kcnab2 antikoerper, KCNAB2 antikoerper, DKFZp459E056 antikoerper, akr6a5 antikoerper, kcna2b antikoerper, kvb-a antikoerper, kvb2 antikoerper, kvbeta2 antikoerper, kvbeta2.1 antikoerper, kvbeta2.2 antikoerper, AKR6A5 antikoerper, HKvbeta2 antikoerper, HKvbeta2.1 antikoerper, HKvbeta2.2 antikoerper, KCNA2B antikoerper, KV-BETA-2 antikoerper, Kvbeta2.1 antikoerper, F5 antikoerper, I2rf5 antikoerper, Kcnb3 antikoerper, kv-beta-2 antikoerper, potassium channel, voltage gated subfamily A regulatory beta subunit 1 antikoerper, potassium voltage-gated channel subfamily A regulatory beta subunit 2 antikoerper, potassium voltage-gated channel, shaker-related subfamily, beta member 2 a antikoerper, potassium channel, voltage gated subfamily A regulatory beta subunit 2 L homeolog antikoerper, voltage-gated potassium channel subunit beta-2 antikoerper, potassium voltage-gated channel, shaker-related subfamily, beta member 2 antikoerper, kcnab1 antikoerper, KCNAB2 antikoerper, kcnab2a antikoerper, kcnab2.L antikoerper, LOC397248 antikoerper, Kcnab2 antikoerper

Hintergrund: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.

Molekulargewicht: 39 kDa (MW of target protein)