KCNAB2 Antikörper (C-Term)

Produktnummer ABIN630079

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch KCNAB2 in WB. Es zeigt Reaktivität gegenüber Proben von Ratte, Human, Maus, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für KCNAB2 Antikörper (C-Term) (ABIN630079)

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Reaktivität: Ratte, Human, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNAB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNAB2 Antikörper

Bindungsspezifität: C-Term

Spezifität: KCNAB2 antibody was raised against the C terminal of KCNAB2

Aufreinigung: Purified

Immunogen: KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNAB2 Blocking Peptide, (ABIN940121), is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNAB2

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Andere Bezeichnung: KCNAB2

Hintergrund: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.

Molekulargewicht: 39 kDa (MW of target protein)