SF3B1 Antikörper (N-Term)

Produktnummer ABIN629906

Der Kaninchen Polyklonal Anti-SF3B1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, SF3B1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für SF3B1 Antikörper (N-Term) (ABIN629906)

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SF3B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SF3B1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SF3 B1 antibody was raised against the N terminal of SF3 1

Aufreinigung: Purified

Immunogen: SF3 B1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF3B1 Blocking Peptide, (ABIN5616087), is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SF3B1

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Andere Bezeichnung: SF3B1

Hintergrund: SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Molekulargewicht: 143 kDa (MW of target protein)

Pathways: Chromatin Binding