SF3B1 Antikörper (Middle Region)
-
- Target Alle SF3B1 Antikörper anzeigen
- SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SF3B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SF3 B1 antibody was raised against the middle region of SF3 1
- Aufreinigung
- Purified
- Immunogen
- SF3 B1 antibody was raised using the middle region of SF3 1 corresponding to a region with amino acids LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG
- Top Product
- Discover our top product SF3B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SF3B1 Blocking Peptide, catalog no. 33R-5171, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))
- Andere Bezeichnung
- SF3B1 (SF3B1 Produkte)
- Synonyme
- Cus1 antikoerper, SAP145 antikoerper, SF3B145 antikoerper, SF3b1 antikoerper, SF3b150 antikoerper, Hsh155 antikoerper, MDS antikoerper, PRP10 antikoerper, PRPF10 antikoerper, SAP155 antikoerper, SF3b155 antikoerper, 155kDa antikoerper, 2810001M05Rik antikoerper, AA409119 antikoerper, Prp10 antikoerper, TA-8 antikoerper, Targ4 antikoerper, hsh155 antikoerper, prp10 antikoerper, prpf10 antikoerper, sap155 antikoerper, SF3B1 antikoerper, Sap155 antikoerper, wu:fb99f09 antikoerper, splicing factor 3b subunit 2 antikoerper, splicing factor 3b subunit 1 antikoerper, splicing factor 3b, subunit 1 antikoerper, splicing factor 3b subunit 1 S homeolog antikoerper, SF3B2 antikoerper, SF3B1 antikoerper, Sf3b1 antikoerper, sf3b1.S antikoerper, sf3b1 antikoerper
- Hintergrund
- SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.
- Molekulargewicht
- 87 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-