PFKL Antikörper (Middle Region)

Produktnummer ABIN629821

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PFKL in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte und Hund.

Kurzübersicht für PFKL Antikörper (Middle Region) (ABIN629821)

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFKL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PFKL Antikörper

Bindungsspezifität: Middle Region

Spezifität: PFKL antibody was raised against the middle region of PFKL

Aufreinigung: Purified

Immunogen: PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PFKL Blocking Peptide, (ABIN5615326), is also available for use as a blocking control in assays to test for specificity of this PFKL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFKL

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Andere Bezeichnung: PFKL

Hintergrund: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Warburg Effekt