PFKL Antikörper (Middle Region)

Produktnummer ABIN629821

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PFKL in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für PFKL Antikörper (Middle Region) (ABIN629821)

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFKL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PFKL Antikörper

Bindungsspezifität: Middle Region

Spezifität: PFKL antibody was raised against the middle region of PFKL

Aufreinigung: Purified

Immunogen: PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PFKL Blocking Peptide, (ABIN5615326), is also available for use as a blocking control in assays to test for specificity of this PFKL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFKL

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Andere Bezeichnung: PFKL

Hintergrund: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Warburg Effekt