METTL7A Antikörper (N-Term)

Produktnummer ABIN629594

Der Kaninchen Polyklonal Anti-METTL7A-Antikörper wurde für WB validiert. Er ist geeignet, METTL7A in Proben von Human und Ratte zu detektieren.

Kurzübersicht für METTL7A Antikörper (N-Term) (ABIN629594)

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL7A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-METTL7A Antikörper

Bindungsspezifität: N-Term

Spezifität: METTL7 A antibody was raised against the N terminal of METTL7

Aufreinigung: Purified

Immunogen: METTL7 A antibody was raised using the N terminal of METTL7 corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METTL7A Blocking Peptide, (ABIN5614733), is also available for use as a blocking control in assays to test for specificity of this METTL7A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL7A

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Andere Bezeichnung: METTL7A

Hintergrund: METTL7A is thought to be a methyltransferase enzyme.

Molekulargewicht: 20 kDa (MW of target protein)