IL-6 Receptor Antikörper (AA 379-419)

Produktnummer ABIN5647855

Der Kaninchen Polyklonal Anti-IL-6 Receptor-Antikörper wurde für WB validiert. Er ist geeignet, IL-6 Receptor in Proben von Human zu detektieren.

Kurzübersicht für IL-6 Receptor Antikörper (AA 379-419) (ABIN5647855)

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-6 Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL-6 Receptor Antikörper

Bindungsspezifität: AA 379-419

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 379-419 (LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) were used as the immunogen for the IL6R antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IL6R antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IL6R antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IL-6 Receptor

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Andere Bezeichnung: IL6R

Hintergrund: Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

UniProt: P08887

Pathways: JAK-STAT Signalweg, Autophagie, Growth Factor Binding, Cancer Immune Checkpoints