Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

BAX Antikörper (AA 17-48)

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch BAX in WB, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.
Produktnummer ABIN5647494
644,88 €
Zzgl. Versandkosten 20,00 € und MwSt
100 μg
Lieferung nach: Deutschland
Lieferung in 6 bis 9 Werktagen

Kurzübersicht für BAX Antikörper (AA 17-48) (ABIN5647494)

Target

Alle BAX Antikörper anzeigen
BAX (BCL2-Associated X Protein (BAX))

Reaktivität

  • 261
  • 168
  • 148
  • 45
  • 28
  • 27
  • 23
  • 19
  • 16
  • 11
  • 10
  • 8
  • 4
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 166
  • 103
  • 3
  • 2
  • 1
Kaninchen

Klonalität

  • 164
  • 111
Polyklonal

Konjugat

  • 145
  • 14
  • 11
  • 9
  • 7
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser BAX Antikörper ist unkonjugiert

Applikation

  • 234
  • 95
  • 91
  • 76
  • 53
  • 52
  • 51
  • 47
  • 39
  • 14
  • 12
  • 8
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Bindungsspezifität

    • 32
    • 25
    • 19
    • 17
    • 15
    • 12
    • 10
    • 10
    • 8
    • 8
    • 6
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 17-48

    Aufreinigung

    Antigen affinity purified

    Immunogen

    Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

    Isotyp

    IgG
  • Applikationshinweise

    Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Lagerung

    -20 °C

    Informationen zur Lagerung

    After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    BAX (BCL2-Associated X Protein (BAX))

    Andere Bezeichnung

    Bax

    Hintergrund

    Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

    UniProt

    Q07812

    Pathways

    p53 Signalweg, PI3K-Akt Signalweg, Apoptose, Caspase Kaskade in der Apoptose, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response
Sie sind hier:
Chat with us!