Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) (AA 224-330) Antikörper Primary Antibody

PPP1CA Reaktivität: Human ELISA, WB Wirt: Maus Polyclonal unconjugated
Produktnummer ABIN562344
$465.71
Zzgl. Versandkosten $45.00
50 μL
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA)
    Bindungsspezifität
    AA 224-330
    • 13
    • 10
    • 6
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reaktivität
    Human
    • 74
    • 44
    • 43
    • 16
    • 9
    • 7
    • 6
    • 5
    • 3
    • 1
    • 1
    • 1
    • 1
    Wirt
    Maus
    • 49
    • 25
    • 1
    • 1
    Klonalität
    Polyklonal
    • 50
    • 25
    Konjugat
    Unkonjugiert
    • 55
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Applikation
    ELISA, Western Blotting (WB)
    • 55
    • 26
    • 18
    • 8
    • 8
    • 7
    • 7
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    Verwendungszweck
    Mouse polyclonal antibody raised against a partial recombinant PPP1CA.
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: PPP1CA (NP_002699, 224 a.a. ~ 330 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA)
    Andere Bezeichnung
    PPP1CA (PPP1CA Antibody Abstract)
    Synonyme
    PP-1A, PP1A, PP1alpha, PPP1A, Ppp1c, dism2, ppp1a, wu:fc04c08, wu:fc09b07, wu:fc30g11, wu:fe05h08, zgc:85729, protein phosphatase 1 catalytic subunit alpha, protein phosphatase 1, catalytic subunit, alpha isoform, protein phosphatase 1, catalytic subunit, alpha isozyme L homeolog, protein phosphatase 1, catalytic subunit, alpha isozyme, protein phosphatase 1, catalytic subunit, alpha isozyme a, PPP1CA, Ppp1ca, ppp1ca.L, ppp1ca, ppp1caa
    Hintergrund
    Full Gene Name: protein phosphatase 1, catalytic subunit, alpha isoform
    Synonyms: MGC15877,MGC1674,PP-1A,PPP1A
    Gen-ID
    5499
    NCBI Accession
    NP_002699, NM_002708
    Pathways
    M Phase, Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Lipid Metabolism
Sie sind hier:
help Kundenservice