Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) (AA 224-330) Antikörper Primary Antibody
-
- Target
- Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA)
- Bindungsspezifität
-
AA 224-330
- Reaktivität
-
Human
- Wirt
-
Maus
- Klonalität
-
Polyklonal
- Konjugat
-
Unkonjugiert
- Applikation
-
ELISA, Western Blotting (WB)
- Verwendungszweck
- Mouse polyclonal antibody raised against a partial recombinant PPP1CA.
- Kreuzreaktivität
- Human
- Immunogen
-
immunogen: PPP1CA (NP_002699, 224 a.a. ~ 330 a.a) partial recombinant protein with GST tag.
Immunogen Sequence: SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
-
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) (Center) antibody Primary Antibody
PPP1CA Reaktivität: Human, Ratte ICC, IF, IHC (p), WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) antibody Primary AntibodyPPP1CA Reaktivität: Human, Maus ELISA, WB Wirt: Maus Monoclonal 6D1 unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) (AA 30-299) antibody Primary AntibodyPPP1CA Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 4G3 unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) antibody Primary AntibodyPPP1CA Reaktivität: Human IF, ELISA, WB Wirt: Maus Monoclonal 6D1 unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) (N-Term) antibody Primary AntibodyPPP1CA Reaktivität: Human, Maus, Ratte, Hund WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) (AA 281-330), (pThr320) antibody Primary AntibodyPPP1CA Reaktivität: Human, Maus, Ratte IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) (AA 281-330) antibody Primary AntibodyPPP1CA Reaktivität: Human, Maus, Ratte IHC, ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) antibody Primary AntibodyPPP1CA Reaktivität: Human, Maus, Ratte IF, IHC, WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA) antibody Primary AntibodyPPP1CA Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 4G3 unconjugated
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- 50 % glycerol
- Handhabung
- Aliquot to avoid repeated freezing and thawing.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA)
- Andere Bezeichnung
- PPP1CA (PPP1CA Antibody Abstract)
- Synonyme
- PP-1A, PP1A, PP1alpha, PPP1A, Ppp1c, dism2, ppp1a, wu:fc04c08, wu:fc09b07, wu:fc30g11, wu:fe05h08, zgc:85729, protein phosphatase 1 catalytic subunit alpha, protein phosphatase 1, catalytic subunit, alpha isoform, protein phosphatase 1, catalytic subunit, alpha isozyme L homeolog, protein phosphatase 1, catalytic subunit, alpha isozyme, protein phosphatase 1, catalytic subunit, alpha isozyme a, PPP1CA, Ppp1ca, ppp1ca.L, ppp1ca, ppp1caa
- Hintergrund
-
Full Gene Name: protein phosphatase 1, catalytic subunit, alpha isoform
Synonyms: MGC15877,MGC1674,PP-1A,PPP1A - Gen-ID
- 5499
- NCBI Accession
- NP_002699, NM_002708
- Pathways
- M Phase, Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Lipid Metabolism
