IL-6 Receptor Antikörper (C-Term)

Produktnummer ABIN5518926

Produktdetails anti-IL-6 Receptor Antikörper

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Bindungsspezifität: AA 379-419, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-6 Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Interleukin-6 receptor subunit alpha(IL6R) detection. Tested with WB in Human.

Sequenz: LLCIAIVLRF KKTWKLRALK EGKTSMHPPY SLGQLVPERP R

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Interleukin-6 receptor subunit alpha(IL6R) detection. Tested with WB in Human.
Gene Name: interleukin 6 receptor
Protein Name: Interleukin-6 receptor subunit alpha

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu IL-6 Receptor

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Andere Bezeichnung: IL6R (IL6R Produkte)

Synonyme: IL6R antikoerper, il-6ra antikoerper, CD126 antikoerper, IL-6R-1 antikoerper, IL-6RA antikoerper, IL6Q antikoerper, IL6RA antikoerper, IL6RQ antikoerper, gp80 antikoerper, IL6R1 antikoerper, Il6ra antikoerper, IL-6Ralpha antikoerper, IL-6R antikoerper, Il6r antikoerper, interleukin 6 receptor antikoerper, interleukin 6 receptor, alpha antikoerper, IL6R antikoerper, il6r antikoerper, Il6r antikoerper, Il6ra antikoerper

Hintergrund: Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

Synonyms: Interleukin-6 receptor subunit alpha, IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane glycoprotein 80, gp80, CD126, IL6R

Gen-ID: 3570

UniProt: P08887

Pathways: JAK-STAT Signalweg, Autophagie, Growth Factor Binding, Cancer Immune Checkpoints