JAK1 Antikörper (N-Term)

Produktnummer ABIN5518768

Produktdetails anti-JAK1 Antikörper

Target: JAK1 (Janus Kinase 1 (JAK1))

Bindungsspezifität: AA 78-115, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JAK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: FALYDENTKL WYAPNRTITV DDKMSLRLHY RMRFYFTN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Janus kinase 1
Protein Name: Tyrosine-protein kinase JAK1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-JAK1 Antikörper (ABIN5518768)

Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).

Details zu JAK1

Target: JAK1 (Janus Kinase 1 (JAK1))

Andere Bezeichnung: JAK1 (JAK1 Produkte)

Synonyme: JAK1A antikoerper, JAK1B antikoerper, JTK3 antikoerper, AA960307 antikoerper, C130039L05Rik antikoerper, wu:fb93e10 antikoerper, jak1 antikoerper, Janus kinase 1 antikoerper, tyrosine-protein kinase JAK1 antikoerper, JAK1 antikoerper, Jak1 antikoerper, jak1 antikoerper, LOC100286690 antikoerper

Hintergrund: JAK1 (JANUS KINASE 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-α/β) and type II (IFN-γ) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

Synonyms: JAK 1A | JAK-1 | JAK1A | JAK1B | Tyrosineprotein kinase JAK1 | Tyrosine-protein kinase JAK1 | P23458

Gen-ID: 3716

UniProt: P23458

Pathways: JAK-STAT Signalweg, RTK Signalweg, Interferon-gamma Pathway, Hepatitis C, Toll-Like Receptors Cascades, Unfolded Protein Response