CSNK1A1 Antikörper

Produktnummer ABIN4950677

Produktdetails anti-CSNK1A1 Antikörper

Target: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSNK1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ of human CSNK1A1 were used as the immunogen for the CSNK1A1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CSNK1A1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CSNK1A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CSNK1A1

Target: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Andere Bezeichnung: CSNK1A1 (CSNK1A1 Produkte)

Synonyme: CK1 antikoerper, CK1a antikoerper, CKIa antikoerper, HLCDGP1 antikoerper, PRO2975 antikoerper, 2610208K14Rik antikoerper, 4632404G05Rik antikoerper, 5430427P18Rik antikoerper, Csnk1a antikoerper, CHUNP6894 antikoerper, ck1alpha antikoerper, wu:fb65a02 antikoerper, wu:fi30h04 antikoerper, wu:fj19c11 antikoerper, zgc:92158 antikoerper, KER1 antikoerper, ck1 antikoerper, CKIALPHA antikoerper, CK-II antikoerper, CSNK2A1 antikoerper, CG2028 antikoerper, CK I antikoerper, CK1alpha antikoerper, CKI antikoerper, CKI alpha antikoerper, CKIalpha antikoerper, CkIa antikoerper, Dmel\\CG2028 antikoerper, PKA-C antikoerper, anon-WO03040301.93 antikoerper, anon-WO03040301.95 antikoerper, ck1a antikoerper, dmCK1 antikoerper, dmckI antikoerper, l(1)G0492 antikoerper, casein kinase 1 alpha 1 antikoerper, casein kinase 1, alpha 1 antikoerper, keratin 1 antikoerper, casein kinase 1 alpha 1 L homeolog antikoerper, casein kinase 2 alpha 1 antikoerper, Casein kinase Ialpha antikoerper, CSNK1A1 antikoerper, Csnk1a1 antikoerper, csnk1a1 antikoerper, KRT1 antikoerper, csnk1a1.L antikoerper, CSNK2A1 antikoerper, CkIalpha antikoerper

Hintergrund: Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

UniProt: P48729

Pathways: WNT Signalweg, Hedgehog Signalweg