KDM5B Antikörper (Middle Region)

Produktnummer ABIN4886648

Produktdetails anti-KDM5B Antikörper

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Bindungsspezifität: AA 641-685, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KDM5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: DVLDVVVAST VQKDMAIMIE DEKALRETVR KLGVIDSERM DFE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: lysine demethylase 5B
Protein Name: Lysine-specific demethylase 5B

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu KDM5B

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Andere Bezeichnung: KDM5B (KDM5B Produkte)

Synonyme: jarid1b antikoerper, jarid1ba antikoerper, id:ibd5050 antikoerper, wu:fd15c05 antikoerper, cb264 antikoerper, jarid1bb antikoerper, plu1 antikoerper, wu:fc44h11 antikoerper, zgc:85741 antikoerper, JARID1B antikoerper, CT31 antikoerper, PLU-1 antikoerper, PLU1 antikoerper, PUT1 antikoerper, RBBP2H1A antikoerper, 2010009J12Rik antikoerper, 2210016I17Rik antikoerper, AW556288 antikoerper, D1Ertd202e antikoerper, Jarid1b antikoerper, Plu1 antikoerper, Rb-Bp2 antikoerper, mKIAA4034 antikoerper, RGD1565602 antikoerper, lysine (K)-specific demethylase 5Ba antikoerper, lysine (K)-specific demethylase 5Bb antikoerper, lysine demethylase 5B antikoerper, lysine (K)-specific demethylase 5B antikoerper, kdm5ba antikoerper, kdm5bb antikoerper, KDM5B antikoerper, Kdm5b antikoerper

Hintergrund: Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.

Synonyms: CT31 | JARID1B | Kdm5b | PLU-1 | PLU1 | PPP1R98 | PUT1 | RBBP2H1A | RBP2-H1 | Q9UGL1

Gen-ID: 10765

Pathways: Warburg Effekt