ERK1 Antikörper (AA 336-367)
Kurzübersicht für ERK1 Antikörper (AA 336-367) (ABIN351563)
Target
Alle ERK1 (MAPK3) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- AA 336-367
-
Spezifität
- This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
-
Homologie
- Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
-
Aufreinigung
- Protein A purified
-
Immunogen
-
A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).
Type of Immunogen: Synthetic peptide - KLH conjugated
-
-
-
-
Applikationshinweise
-
Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB
Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract. -
Kommentare
-
Target Species of Antibody: Rat
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Liquid
-
Konzentration
- Lot specific
-
Buffer
- Liquid
-
Handhabung
- Avoid repeat freeze-thaw cycles.
-
Lagerung
- 4 °C,-20 °C
-
Informationen zur Lagerung
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
-
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
-
Andere Bezeichnung
- MAPK3 / ERK1
-
Hintergrund
-
Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase
Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3 -
Gen-ID
- 5595
-
UniProt
- P27361
-
Pathways
- MAPK Signalweg, RTK Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteine
Target
-