ERK1 Antikörper (AA 336-367)

Produktnummer ABIN351563

Produktdetails anti-ERK1 Antikörper

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Bindungsspezifität: AA 336-367

Reaktivität: Maus, Ratte, Kaninchen, Hamster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Spezifität: This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.

Homologie: Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).

Aufreinigung: Protein A purified

Immunogen: A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated

Anwendungsinformationen

Applikationshinweise: Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.

Kommentare:

Target Species of Antibody: Rat

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: Liquid

Handhabung: Avoid repeat freeze-thaw cycles.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Details zu ERK1

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Andere Bezeichnung: MAPK3 / ERK1 (MAPK3 Produkte)

Hintergrund: Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3

Gen-ID: 5595

UniProt: P27361

Pathways: MAPK Signalweg, RTK Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteine