TLR5 Antikörper (AA 151-181)

Produktnummer ABIN342758

Produktdetails anti-TLR5 Antikörper

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Bindungsspezifität: AA 151-181

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser TLR5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunocytochemistry (ICC), Flow Cytometry (FACS)

Spezifität: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%) Colobus monkey, Baboon (97%) Marmoset (94%) Sheep, Goat, Panda, Water buffalo (84%) Zebu, Bovine (81%).

Aufreinigung: Immunoaffinity purified

Immunogen: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%), Colobus monkey, Baboon (97%), Marmoset (94%), Sheep, Goat, Panda, Water buffalo (84%), Zebu, Bovine (81%).

Type of Immunogen: Synthetic peptide

Anwendungsinformationen

Applikationshinweise: Approved: ELISA (1:35000), Flo (1:50), ICC (1:250), IHC (1:125), WB (1:100)

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid freeze-thaw cycles.

Lagerung: -20 °C,-80 °C

Informationen zur Lagerung: Short term: -20°C
Long term: -70°C
Avoid freeze-thaw cycles.

Details zu TLR5

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Andere Bezeichnung: TLR5 (TLR5 Produkte)

Synonyme: SLEB1 antikoerper, TIL3 antikoerper, TLR-5 antikoerper, sleb1 antikoerper, til3 antikoerper, tlr-5 antikoerper, tlr5 antikoerper, toll like receptor 5 antikoerper, toll-like receptor 5 antikoerper, toll like receptor 5 L homeolog antikoerper, toll-like receptor 5b antikoerper, TLR5 antikoerper, Tlr5 antikoerper, tlr5.L antikoerper, tlr-5 antikoerper, tlr5b antikoerper

Hintergrund: Name/Gene ID: TLR5
Family: Toll-like Receptor

Synonyms: TLR5, TIL3, Toll-like receptor 5, SLEB1

Gen-ID: 7100

UniProt: O60602

Pathways: TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades