Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) (AA 277-309), (C-Term) Antikörper

Details zu Produkt Nr. ABIN3043846
Antigen
Epitop
AA 277-309, C-Term
15
15
13
9
9
8
8
7
6
4
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
96
53
47
2
2
2
2
1
1
1
1
1
1
Wirt
Kaninchen
98
6
1
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
6
5
5
3
3
3
3
3
3
2
2
2
2
2
2
2
2
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
72
41
30
26
18
17
6
3
3
Optionen
Verwendungszweck Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Sequenz EKRKQLLLAN LPQELLQAYG KDYIEHLHGQ FLH
Isotyp IgG
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: hydroxysteroid (11-beta) dehydrogenase 2
Protein Name: Corticosteroid 11-beta-dehydrogenase isozyme 2
Reinigung Immunogen affinity purified.
Antigen
Andere Bezeichnung HSD11B2 (HSD11B2 Antibody Abstract)
Hintergrund Corticosteroid 11-β-dehydrogenase isozyme 2, also known as 11-β-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.

Synonyms: 11 beta HSD2 antibody|11 beta hydroxysteroid dehydrogenase type 2 antibody|11 DH2 antibody|11-beta-HSD2 antibody|11-beta-hydroxysteroid dehydrogenase type 2 antibody|11-DH2 antibody|AME antibody|AME1 antibody|Corticosteroid 11 beta dehydrogenase isozyme 2 antibody|Corticosteroid 11-beta-dehydrogenase isozyme 2 antibody|DHI2_HUMAN antibody|HSD11B2 antibody|HSD11K antibody|HSD2 antibody| Hydroxysteroid 11 beta dehydrogenase 2 antibody|Hydroxysteroid 11 beta dehydrogenase isoenzyme 2 antibody|NAD dependent 11 beta hydroxysteroid dehydrogenase antibody|NAD-dependent 11-beta-hydroxysteroid dehydrogenase antibody|SDR9C3 antibody|Short chain dehydrogenase/reductase family 9C, member 3 antibody
Gen-ID 3291
UniProt P80365
Pathways Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) (AA 277-309), (C-Term) antibody (ABIN3043846) Anti- HSD11B2 antibody, IHC(P) IHC(P): Mouse Pancreas Tissue
Image no. 2 for anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) (AA 277-309), (C-Term) antibody (ABIN3043846) Anti- HSD11B2 antibody, IHC(P) IHC(P): Human Placenta Tissue
Image no. 3 for anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) (AA 277-309), (C-Term) antibody (ABIN3043846) anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) (AA 277-309), (C-Term) antibody (Image 3)
Image no. 4 for anti-Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2) (AA 277-309), (C-Term) antibody (ABIN3043846) Anti- HSD11B2 antibody, IHC(P) IHC(P): Rat Pancreas Tissue