ERK1 Antikörper (AA 372-406)
-
- Target Alle ERK1 (MAPK3) Antikörper anzeigen
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
-
Bindungsspezifität
- AA 372-406
-
Reaktivität
- Maus, Ratte, Kaninchen, Hamster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)
- Spezifität
- Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
- Homologie
- Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
- Aufreinigung
- Immunoaffinity purified
- Immunogen
-
Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).
Type of Immunogen: Synthetic peptide - KLH conjugated - Isotyp
- IgG
- Top Product
- Discover our top product MAPK3 Primärantikörper
-
-
- Applikationshinweise
-
Approved: Func, IP, WB (0.1 - 2 μg/mL)
Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit. - Kommentare
-
Target Species of Antibody: Rat
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- 0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeat freeze-thaw cycles.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
- Andere Bezeichnung
- MAPK3 / ERK1 (MAPK3 Produkte)
- Hintergrund
-
Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase
Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3 - Gen-ID
- 5595
- UniProt
- P27361
- Pathways
- MAPK Signalweg, RTK Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteine
-