TLR5 Antikörper
-
- Target Alle TLR5 Antikörper anzeigen
- TLR5 (Toll-Like Receptor 5 (TLR5))
-
Reaktivität
- Human
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TLR5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF)
- Spezifität
- Recognizes human Toll-like receptor 5 (TLR5). Peptide sequence is >50% identical to other human TLRs in this region. Species Reactivity: Human. Other species not tested.
- Immunogen
- Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5.
- Top Product
- Discover our top product TLR5 Primärantikörper
-
anti-Toll-Like Receptor 5 (TLR5) (AA 325-644) antibody
TLR5 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 5 (TLR5) (AA 303-514) antibodyTLR5 Reaktivität: Human WB, ELISA, ICC, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 5 (TLR5) (AA 693-858) antibodyTLR5 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 5 (TLR5) (AA 693-858) antibodyTLR5 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C6 unconjugated
anti-Toll-Like Receptor 5 (TLR5) (AA 682-850) antibodyTLR5 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 5 (TLR5) (AA 700-800) antibodyTLR5 Reaktivität: Human, Maus WB, IHC, FACS, IHC (fro) Wirt: Maus Monoclonal 19D759-2 unconjugated
anti-Toll-Like Receptor 5 (TLR5) (AA 701-810) antibodyTLR5 Reaktivität: Human, Maus WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 5 (TLR5) (AA 517-634) antibodyTLR5 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1A11 unconjugated
anti-Toll-Like Receptor 5 (TLR5) (N-Term) antibodyTLR5 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Toll-Like Receptor 5 (TLR5) (C-Term) antibodyTLR5 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Flow Cytometry Immunocytochemistry: 1:500 Immunohistochemistry: Paraffin sections 1:250 Western blot The optimal dilution for a specific application should be determined by the researcher.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- Liquid. 100 µg of peptide affinity purified antibody in PBS at 2 mg/ml, containing 1 mg/ml BSA and 0.1% sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C
-
- Target
- TLR5 (Toll-Like Receptor 5 (TLR5))
- Andere Bezeichnung
- TLR5 (TLR5 Produkte)
- Pathways
- TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades
-
