TLR5 Antikörper

Produktnummer ABIN187770

Dieses Anti-TLR5-Antikörper ist ein Ziege Polyklonal-Antikörper zur Detektion von TLR5 in WB, FACS, IHC (p) und IF. Geeignet für Human.

Kurzübersicht für TLR5 Antikörper (ABIN187770)

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser TLR5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF)

Produktdetails anti-TLR5 Antikörper

Spezifität: Recognizes human Toll-like receptor 5 (TLR5). Peptide sequence is >50% identical to other human TLRs in this region. Species Reactivity: Human. Other species not tested.

Immunogen: Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5.

Anwendungsinformationen

Applikationshinweise: Flow Cytometry Immunocytochemistry: 1:500 Immunohistochemistry: Paraffin sections 1:250 Western blot The optimal dilution for a specific application should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Liquid. 100 µg of peptide affinity purified antibody in PBS at 2 mg/ml, containing 1 mg/ml BSA and 0.1% sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Details zu TLR5

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Andere Bezeichnung: TLR5

Pathways: TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades