Caspase 3 Antikörper (AA 183-277) (Biotin)
-
- Target Alle Caspase 3 (CASP3) Antikörper anzeigen
- Caspase 3 (CASP3)
-
Bindungsspezifität
- AA 183-277
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Caspase 3 Antikörper ist konjugiert mit Biotin
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), ELISA
- Sequenz
- MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF- ACHKIPVE ADFLYAYSTA PGYYSWRNSK DGSWFIQSLC AMLKQYADKL EFMHILTRVN RKVATEFESF SFDATFHAKK QIPCIVSMLT KELYFYH
- Spezifität
- It has been selected for its ability to recognize CASP3 in immunohistochemical staining and Western blotting.
- Aufreinigung
- Affinity Chromatography
- Immunogen
-
Recombinant CASP3 expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against CASP3 conjugated to biotin. - Isotyp
- IgG
- Top Product
- Discover our top product CASP3 Primärantikörper
-
-
- Applikationshinweise
-
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user. - Kommentare
-
Content: The quality control contains recombinant CASP3 (Ala183~His277) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % . - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handhabung
- Avoid repeated freeze/thaw cycles
- Lagerung
- 4 °C
- Informationen zur Lagerung
- Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
- Haltbarkeit
- 12 months
-
- Target
- Caspase 3 (CASP3)
- Abstract
- CASP3 Produkte
- Synonyme
- CPP32 antikoerper, CPP32B antikoerper, SCA-1 antikoerper, A830040C14Rik antikoerper, AC-3 antikoerper, Apopain antikoerper, CC3 antikoerper, Caspase-3 antikoerper, Lice antikoerper, Yama antikoerper, mldy antikoerper, xcpp32 antikoerper, casp3 antikoerper, zgc:100890 antikoerper, CASP-3 antikoerper, caspase-3 antikoerper, caspase 3 antikoerper, caspase 3 S homeolog antikoerper, caspase 3, apoptosis-related cysteine peptidase a antikoerper, caspase 3, apoptosis-related cysteine peptidase antikoerper, CASP3 antikoerper, Casp3 antikoerper, casp3.S antikoerper, casp3a antikoerper
- Pathways
- Apoptose, Caspase Kaskade in der Apoptose, Sensory Perception of Sound, ER-Nucleus Signaling, Positive Regulation of Endopeptidase Activity, Activated T Cell Proliferation
-