AIF Antikörper (AA 151-180)

Produktnummer ABIN1099879

Produktdetails anti-AIF Antikörper

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Bindungsspezifität: AA 151-180

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marke: IHC-plus™

Aufreinigung: Affinity purified

Immunogen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: IHC, IHC-P (5 μg/mL), WB

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: TBS containing 50 % glycerol, 0.5 mg/mL BSA, and 0.02 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.

Details zu AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Andere Bezeichnung: AIFM1 / AIF / PDCD8 (AIFM1 Produkte)

Synonyme: AIF antikoerper, CMTX4 antikoerper, COWCK antikoerper, COXPD6 antikoerper, PDCD8 antikoerper, CG7263 antikoerper, DmAIF antikoerper, Dmel\\CG7263 antikoerper, GB16024 antikoerper, DDBDRAFT_0187853 antikoerper, DDBDRAFT_0191137 antikoerper, DDB_0187853 antikoerper, DDB_0191137 antikoerper, aif antikoerper, pdcd8 antikoerper, AIFM1 antikoerper, PCD8 antikoerper, AIFsh2 antikoerper, Hq antikoerper, Pdcd8 antikoerper, mAIF antikoerper, Aif antikoerper, zgc:91994 antikoerper, apoptosis inducing factor mitochondria associated 1 antikoerper, allograft inflammatory factor 1 antikoerper, Apoptosis inducing factor antikoerper, apoptosis-inducing factor 1, mitochondrial antikoerper, apoptosis inducing factor antikoerper, apoptosis inducing factor, mitochondria associated 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated, 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated 1 antikoerper, AIFM1 antikoerper, AIF1 antikoerper, AIF antikoerper, LOC412212 antikoerper, aif antikoerper, aifm1 antikoerper, Aifm1 antikoerper

Hintergrund: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

Gen-ID: 9131

UniProt: O95831

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effekt