anti-Human WDR1 Antikörper für Immunofluorescence

Recommended WDR1 Antibody (geliefert von: Anmelden zum Anzeigen )

WD Repeat Domain 1 (WDR1) Antikörper
  • AIP1
  • NORI-1
  • Aip1
  • D5Wsu185e
  • rede
  • WD repeat domain 1
  • WDR1
  • Wdr1
Immunocytochemistry (ICC), Immunofluorescence (IF)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5080520
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.178302 ABIN4365952 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2735499 EIA ICC IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal


Antigen WD Repeat Domain 1 (WDR1) Antikörper
Reaktivität Human
(40), (12), (12), (4), (4), (4), (4), (4), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(40), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(36), (10), (8), (5), (3), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-WDR1 Antikörper

Target Details WDR1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQL
Isotyp IgG

Target Details WDR1

Produktdetails anti-WDR1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung WDR1 (WDR1 Antibody Abstract)
Hintergrund Gene Symbol: WDR1
Gen-ID 9948
Pathways Sensory Perception of Sound


Produktdetails anti-WDR1 Antikörper Target Details WDR1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-WDR1 Antikörper Target Details WDR1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-WDR1 Antikörper Target Details WDR1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-WD Repeat Domain 1 (WDR1) antibody (ABIN5080520) Immunocytochemistry/Immunofluorescence: WDR1 Antibody - Staining of human cell line ...