anti-Human TECTA Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended TECTA Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Tectorin alpha (TECTA) Antikörper
  • DFNA12
  • DFNA8
  • DFNB21
  • Tctna
  • tectorin alpha
  • TECTA
  • Tecta
Epitop
AA 93-134, N-Term
3
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
8
1
1
Wirt
Kaninchen
5
3
Klonalität
Polyklonal
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
5
5
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN5518790
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4358355 IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Tectorin alpha (TECTA) Antikörper
Epitop AA 93-134, N-Term
(3), (2), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(8), (1), (1)
Wirt Kaninchen
(5), (3)
Klonalität
Polyklonal
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(5), (5), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TECTA Antikörper

Target Details TECTA Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequenz RAFVAPFWAD VHNGIRGEIY YRETMEPAIL KRATKDIRKY FK
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tectorin alpha
Protein Name: Alpha-tectorin
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
Isotyp IgG

Target Details TECTA

Produktdetails anti-TECTA Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TECTA (TECTA Antibody Abstract)
Hintergrund Alpha-tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

Synonyms: Alpha-tectorin | DFNA12 | DFNA8 | DFNB21 | TECTA | O75443
Gen-ID 7007
UniProt O75443
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-TECTA Antikörper Target Details TECTA Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TECTA Antikörper Target Details TECTA Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.