anti-Human SPTBN4 Antikörper für Immunohistochemistry

Recommended SPTBN4 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Spectrin Beta, Non-Erythrocytic 4 (SPTBN4) Antikörper
  • qv
  • dyn
  • lnd
  • SpbIV
  • ROSA62
  • nmf261
  • nmf379
  • 1700022P15Rik
  • 5830426A08Rik
  • Spnb4
  • QV
  • SPNB4
  • SPTBN3
  • spectrin beta, non-erythrocytic 4
  • spectrin, beta, non-erythrocytic 4
  • Sptbn4
  • SPTBN4
  • LOC100342347
Reaktivität
Human
22
15
15
2
Wirt
Kaninchen
15
5
2
Klonalität
Polyklonal
Konjugat
Dieser SPTBN4 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
18
16
15
14
4
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4355773
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5079849 ICC IF IHC WB Mouse IgG1 AA 1621-1832 Anmelden zum Anzeigen S393-2
1 ABIN5632428 ICC IF IHC WB Alexa Fluor 488 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632427 ICC IF IHC WB Alexa Fluor 405 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632432 ICC IF IHC WB DyLight 350 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632431 ICC IF IHC WB Biotin Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632435 ICC IF IHC WB DyLight 550 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632434 ICC IF IHC WB DyLight 488 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632437 ICC IF IHC WB DyLight 680 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632436 ICC IF IHC WB DyLight 650 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632430 ICC IF IHC WB Alexa Fluor 700 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632433 ICC IF IHC WB DyLight 405 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632438 ICC IF IHC WB DyLight 755 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632429 ICC IF IHC WB Alexa Fluor 647 Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632439 ICC IF IHC FITC Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN5632440 IHC WB HRP Mouse IgG1 AA 1621-1832, C-Term Anmelden zum Anzeigen S393-2
1 ABIN1871134 ICC IHC IP WB Rabbit IgG AA 64-285 Anmelden zum Anzeigen Polyclonal
1 ABIN2366133 IHC Goat AA 2-14 Anmelden zum Anzeigen Polyclonal
1 ABIN2912403 ELISA IF/ICC IHC WB Rabbit AA 64-285 Anmelden zum Anzeigen Polyclonal

General

Antigen Spectrin Beta, Non-Erythrocytic 4 (SPTBN4) Antikörper
Reaktivität Human
(22), (15), (15), (2)
Wirt Kaninchen
(15), (5), (2)
Klonalität
Polyklonal
Konjugat Dieser SPTBN4 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(18), (16), (15), (14), (4), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SPTBN4 Antikörper

Target Details SPTBN4 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:AWEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLP
Isotyp IgG

Target Details SPTBN4

Produktdetails anti-SPTBN4 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SPTBN4 (SPTBN4 Antibody Abstract)
Hintergrund Gene Symbol: SPTBN4
Gen-ID 57731
Pathways Sensory Perception of Sound, Regulation of Actin Filament Polymerization, Maintenance of Protein Location

Anwendungsinformationen

Produktdetails anti-SPTBN4 Antikörper Target Details SPTBN4 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SPTBN4 Antikörper Target Details SPTBN4 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SPTBN4 Antikörper Target Details SPTBN4 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Spectrin Beta, Non-Erythrocytic 4 (SPTBN4) antibody (ABIN4355773) Immunohistochemistry: SPTBN4 Antibody [NBP2-49131] - Staining of human cerebral corte...
Immunofluorescence (IF) image for anti-Spectrin Beta, Non-Erythrocytic 4 (SPTBN4) antibody (ABIN4355773) Immunocytochemistry/Immunofluorescence: SPTBN4 Antibody - Staining of human cell lin...