anti-Human Myosin VI Antikörper für Immunohistochemistry

Recommended Myosin VI Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Myosin VI (MYO6) Antikörper
  • 95F
  • 95F MHC
  • CG5695
  • Dm 95F
  • Dm95F
  • Dmel\\CG5695
  • Dro95F
  • JAG
  • Jaguar
  • Jar
  • M6
  • MHC95F
  • MYOVI
  • Mhc95F
  • MyoVI
  • Myosin VI
  • jag
  • ms(3)06746
  • myosins VI
  • DFNA22
  • DFNB37
  • BC029719
  • Tlc
  • sv
  • RGD1560646
  • CMY6
  • jaguar
  • myosin VI
  • jar
  • LOC373230
  • LOC100223124
  • LOC100351334
  • myo6
  • MYO6
  • Myo6
Reaktivität
Human
46
18
18
2
2
Wirt
Kaninchen
44
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
31
19
19
17
13
9
7
3
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4337146
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1915740 ELISA ICC IF IHC WB Alkaline Phosphatase (AP) Rabbit IgG AA 1166-1195 Anmelden zum Anzeigen Polyclonal
1 ABIN1915744 ELISA ICC IF IHC WB PE Rabbit IgG AA 1166-1195 Anmelden zum Anzeigen Polyclonal
1 ABIN1915742 ELISA ICC IF IHC WB Biotin Rabbit IgG AA 1166-1195 Anmelden zum Anzeigen Polyclonal
1 ABIN1915745 ELISA ICC IF IHC WB HRP Rabbit IgG AA 1166-1195 Anmelden zum Anzeigen Polyclonal
1 ABIN1915741 ELISA ICC IF IHC WB APC Rabbit IgG AA 1166-1195 Anmelden zum Anzeigen Polyclonal
1 ABIN1915743 ELISA ICC IF IHC WB FITC Rabbit IgG AA 1166-1195 Anmelden zum Anzeigen Polyclonal
1 ABIN2312644 IF IHC ELISA WB APC Rabbit IgG AA 1173-1203, Arg1181, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2312630 IHC ELISA WB HRP Rabbit IgG AA 1173-1203, Arg1181, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2312638 IF IHC ELISA WB Rabbit IgG AA 1173-1203, Arg1181, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2312626 IF IHC ELISA WB FITC Rabbit IgG AA 1173-1203, Arg1181, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2312633 IF IHC ELISA WB PE Rabbit IgG AA 1173-1203, Arg1181, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2585414 ELISA IF IHC WB Rabbit IgG AA 1173-1203 Anmelden zum Anzeigen Polyclonal
1 ABIN2312624 IF IHC ELISA WB Biotin Rabbit IgG AA 1173-1203, Arg1181, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2312641 IF IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 1173-1203, Arg1181, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN797702 IP IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN4337145 IHC IHC (p) Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2797384 IF IHC WB Rabbit Ig Fraction C-Term Anmelden zum Anzeigen Polyclonal

General

Antigen Myosin VI (MYO6) Antikörper
Reaktivität Human
(46), (18), (18), (2), (2)
Wirt Kaninchen
(44), (2)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(31), (19), (19), (17), (13), (9), (7), (3), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: DGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYD

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MYO6 (MYO6 Antibody Abstract)
Hintergrund Gene Symbol: MYO6
Gen-ID 4646
UniProt Q9UM54
Forschungsgebiet Signaling, Cytoskeleton
Pathways Sensory Perception of Sound, Dicarboxylic Acid Transport, Asymmetric Protein Localization

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Myosin VI (MYO6) antibody (ABIN4337146) Immunohistochemistry: MYO6 Antibody [NBP2-38254] - Staining of human kidney shows str...