anti-Human Myosin XV Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Myosin XV Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Myosin XV (MYO15) Antikörper
  • 10A
  • AAF47980
  • CG16922
  • CG2136
  • CG2174
  • CG43657
  • DmXV
  • Dmel\\CG43657
  • Dmel_CG16922
  • Dmel_CG2174
  • Syph
  • myo10A
  • Myo15a
  • sh-2
  • sh2
  • DFNB3
  • MYO15
  • Myo15
  • RGD1561873
  • Myosin 10A
  • myosin XVA
  • myosin xv
  • myosin XV
  • Myo10A
  • MYO15A
  • AaeL_AAEL011436
  • CpipJ_CPIJ016115
  • Smp_127510
  • Myo15
  • Myo15a
Reaktivität
Human
6
2
2
Wirt
Kaninchen
4
2
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
6
6
4
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4337133
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Myosin XV (MYO15) Antikörper
Reaktivität Human
(6), (2), (2)
Wirt Kaninchen
(4), (2)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(6), (6), (4), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FPQPTQQIKNIVRQYQQPFRGGRPEALRKDGGKVFMKRPDPHEEALMILK GQMTHLAAAPGTQVSREAVALVKPVTSAPRPSMAPTSALPSRSLEPPEEL TQTRLHRLINPNFYGYQD
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung MYO15A (MYO15 Antibody Abstract)
Hintergrund Gene Symbol: MYO15A
Gen-ID 51168
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: "Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria." in: PLoS pathogens, Vol. 10, Issue 4, pp. e1004038, 2014

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Myosin XV (MYO15) antibody (ABIN4337133) Immunohistochemistry: MYO15A Antibody [NBP2-13635] - Staining of human smooth muscle ...