anti-Human COL11A1 Antikörper für Immunocytochemistry

Recommended COL11A1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Collagen, Type XI, alpha 1 (COL11A1) Antikörper
  • wu:fb34e11
  • wu:fc11b03
  • zgc:158335
  • col11a1
  • Col11a1
  • CO11A1
  • COLL6
  • STL2
  • C530001D20Rik
  • cho
  • collagen, type XI, alpha 1
  • collagen, type XI, alpha 1a
  • collagen, type V, alpha 3
  • collagen type XI alpha 1
  • COL11A1
  • col11a1a
  • col5a3
  • COLL11A1
  • Col11a1
Reaktivität
Human
28
11
3
3
1
1
1
1
1
Wirt
Kaninchen
23
8
Klonalität
Polyklonal
Konjugat
Dieser COL11A1 Antikörper ist unkonjugiert
3
3
3
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
20
16
4
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076030
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5619317 ICC IF IHC WB Rabbit Center Anmelden zum Anzeigen Polyclonal

General

Antigen Collagen, Type XI, alpha 1 (COL11A1) Antikörper
Reaktivität Human
(28), (11), (3), (3), (1), (1), (1), (1), (1)
Wirt Kaninchen
(23), (8)
Klonalität
Polyklonal
Konjugat Dieser COL11A1 Antikörper ist unkonjugiert
(3), (3), (3), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(20), (16), (4), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-COL11A1 Antikörper

Target Details COL11A1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
Isotyp IgG

Target Details COL11A1

Produktdetails anti-COL11A1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung COL11A1 (COL11A1 Antibody Abstract)
Hintergrund Gene Symbol: COL11A1
Gen-ID 1301
Forschungsgebiet Signaling, Extracellular Matrix
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-COL11A1 Antikörper Target Details COL11A1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-COL11A1 Antikörper Target Details COL11A1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-COL11A1 Antikörper Target Details COL11A1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Collagen, Type XI, alpha 1 (COL11A1) antibody (ABIN5076030) Immunocytochemistry/Immunofluorescence: COL11A1 Antibody - Staining of human cell li...