anti-Maus RHOG Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended RHOG Antibody (geliefert von: Anmelden zum Anzeigen )

Ras Homolog Family Member G (RHOG) Antikörper
  • 2810426G09Rik
  • Arhg
  • Sid10750
  • ARHG
  • rhog
  • zgc:55848
  • wu:fk30f01
  • ras homolog gene family, member G
  • ras homolog gene family, member Gb
  • ras homolog gene family, member G (rho G)
  • ras homolog family member G
  • Rhog
  • rhogb
  • RHOG
Human, Maus, Ratte (Rattus)
Dieser RHOG Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4350435
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1492758 IHC (p) WB Rabbit AA 112-161 Anmelden zum Anzeigen Polyclonal
1 ABIN1711405 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1700388 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1713890 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

anti-RHOG Antikörper für Immunohistochemistry (Paraffin-embedded Sections) mit den meisten Publikationen

  • Human Polyclonal RHOG Primary Antibody für IHC, IHC (p) - ABIN4350435 (1 Publications): Sahu, Kumar, Sreenivasamurthy, Selvan, Madugundu, Yelamanchi, Puttamallesh, Dey, Anil, Srinivasan, Mukherjee, Gowda, Satishchandra, Mahadevan, Pandey, Prasad, Shankar: Host response profile of human brain proteome in toxoplasma encephalitis co-infected with HIV. in Clinical proteomics 2014 (PubMed)

Ähnliche anti-RHOG Antikörper

Applikation / Reaktivität Ratte (Rattus) Maus Human
ELISA 4 Antikörper 4 Antikörper 21 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper 13 Antikörper 13 Antikörper
Immunohistochemistry (IHC) 5 Antikörper 5 Antikörper 7 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antikörper 5 Antikörper 5 Antikörper
Western Blotting (WB) 11 Antikörper 13 Antikörper 36 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper


Antigen Ras Homolog Family Member G (RHOG) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(48), (25), (23), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(45), (3)
Konjugat Dieser RHOG Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (21), (13), (6), (4), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RHOG Antikörper

Target Details RHOG Anwendungsinformationen Handhabung ProductDetails: References for anti-RHOG antibody (ABIN4350435) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
Isotyp IgG

Target Details RHOG

Produktdetails anti-RHOG Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-RHOG antibody (ABIN4350435) Bilder zurück nach oben
Andere Bezeichnung RhoG (RHOG Antibody Abstract)
Hintergrund Gene Symbol: RHOG
Gen-ID 391
Pathways RTK Signalweg


Produktdetails anti-RHOG Antikörper Target Details RHOG Handhabung ProductDetails: References for anti-RHOG antibody (ABIN4350435) Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen ProductDetails: References for anti-RHOG antibody (ABIN4350435) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-RHOG antibody (ABIN4350435)

Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Sahu, Kumar, Sreenivasamurthy, Selvan, Madugundu, Yelamanchi, Puttamallesh, Dey, Anil, Srinivasan, Mukherjee, Gowda, Satishchandra, Mahadevan, Pandey, Prasad, Shankar: "Host response profile of human brain proteome in toxoplasma encephalitis co-infected with HIV." in: Clinical proteomics, Vol. 11, Issue 1, pp. 39, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry


Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen Handhabung ProductDetails: References for anti-RHOG antibody (ABIN4350435) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RHOG Antikörper (Ras Homolog Family Member G) (ABIN4350435) Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining of human tonsil ...
Western Blotting (WB) image for anti-RHOG Antikörper (Ras Homolog Family Member G) (ABIN4350435) Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Western Blotting (WB) image for anti-RHOG Antikörper (Ras Homolog Family Member G) (ABIN4350435) Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...