anti-Maus RHOG Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended RHOG Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Ras Homolog Family Member G (RHOG) Antikörper
  • 2810426G09Rik
  • Arhg
  • Sid10750
  • ARHG
  • rhog
  • zgc:55848
  • wu:fk30f01
  • ras homolog gene family, member G
  • ras homolog gene family, member Gb
  • ras homolog gene family, member G (rho G)
  • ras homolog family member G
  • Rhog
  • rhogb
  • RHOG
Reaktivität
Human, Maus, Ratte (Rattus)
48
25
23
2
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
45
3
Klonalität
Polyklonal
Konjugat
Dieser RHOG Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
35
21
13
6
4
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4350435
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1492758 IHC (p) WB Rabbit AA 112-161 Anmelden zum Anzeigen Polyclonal
1 ABIN1711405 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1700388 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1713890 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Ras Homolog Family Member G (RHOG) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(48), (25), (23), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(45), (3)
Klonalität
Polyklonal
Konjugat Dieser RHOG Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (21), (13), (6), (4), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RHOG Antikörper

Target Details RHOG Anwendungsinformationen Handhabung Referenzen für anti-RHOG Antikörper (ABIN4350435) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
Isotyp IgG

Target Details RHOG

Produktdetails anti-RHOG Antikörper Anwendungsinformationen Handhabung Referenzen für anti-RHOG Antikörper (ABIN4350435) Bilder zurück nach oben
Antigen
Andere Bezeichnung RhoG (RHOG Antibody Abstract)
Hintergrund Gene Symbol: RHOG
Gen-ID 391
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-RHOG Antikörper Target Details RHOG Handhabung Referenzen für anti-RHOG Antikörper (ABIN4350435) Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen Referenzen für anti-RHOG Antikörper (ABIN4350435) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-RHOG Antikörper (ABIN4350435)

Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Sahu, Kumar, Sreenivasamurthy, Selvan, Madugundu, Yelamanchi, Puttamallesh, Dey, Anil, Srinivasan, Mukherjee, Gowda, Satishchandra, Mahadevan, Pandey, Prasad, Shankar: "Host response profile of human brain proteome in toxoplasma encephalitis co-infected with HIV." in: Clinical proteomics, Vol. 11, Issue 1, pp. 39, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Bilder

Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen Handhabung Referenzen für anti-RHOG Antikörper (ABIN4350435) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ras Homolog Family Member G (RHOG) antibody (ABIN4350435) Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining of human tonsil ...
Western Blotting (WB) image for anti-Ras Homolog Family Member G (RHOG) antibody (ABIN4350435) Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Western Blotting (WB) image for anti-Ras Homolog Family Member G (RHOG) antibody (ABIN4350435) Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...