anti-Human RHOG Antikörper für Immunohistochemistry

Recommended RHOG Antibody (geliefert von: Anmelden zum Anzeigen )

Ras Homolog Family Member G (RHOG) Antikörper
  • 2810426G09Rik
  • Arhg
  • Sid10750
  • ARHG
  • rhog
  • zgc:55848
  • wu:fk30f01
  • ras homolog gene family, member G
  • ras homolog gene family, member Gb
  • ras homolog gene family, member G (rho G)
  • ras homolog family member G
  • Rhog
  • rhogb
  • RHOG
Dieser RHOG Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4894138
341,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2788364 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4350435 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 1
1 ABIN3186755 ELISA IHC WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2893806 IHC WB Rabbit Gln132 Anmelden zum Anzeigen Polyclonal
1 ABIN2579041 ELISA IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4241901 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal

anti-RHOG Antikörper für Immunohistochemistry mit den meisten Publikationen

  • Human Polyclonal RHOG Primary Antibody für IHC, IHC (p) - ABIN4350435 (1 Publications): Sahu, Kumar, Sreenivasamurthy, Selvan, Madugundu, Yelamanchi, Puttamallesh, Dey, Anil, Srinivasan, Mukherjee, Gowda, Satishchandra, Mahadevan, Pandey, Prasad, Shankar: Host response profile of human brain proteome in toxoplasma encephalitis co-infected with HIV. in Clinical proteomics 2014 (PubMed)

Ähnliche anti-RHOG Antikörper

Applikation / Reaktivität Human
ELISA 21 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 7 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antikörper
Western Blotting (WB) 36 Antikörper


Antigen Ras Homolog Family Member G (RHOG) Antikörper
Epitop C-Term
(12), (9), (8), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Reaktivität Human
(48), (26), (24), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(45), (3)
Konjugat Dieser RHOG Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(35), (21), (13), (6), (5), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RHOG Antikörper

Target Details RHOG Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ.

Target Details RHOG

Produktdetails anti-RHOG Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung RhoG (RHOG Antibody Abstract)
Hintergrund Gene Symbol: RHOG
Molekulargewicht Theoretical MW: 21 kDa
Gen-ID 391
NCBI Accession NP_001656
Pathways RTK Signalweg


Produktdetails anti-RHOG Antikörper Target Details RHOG Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:1000, ImmunohistochemistryThis is a rabbit polyclonal antibody against RHOG and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.


Produktdetails anti-RHOG Antikörper Target Details RHOG Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-RHOG Antikörper (Ras Homolog Family Member G) (C-Term) (ABIN4894138) Western Blot: RhoG Antibody [NBP1-79794] - Jurkat cell lysate, concentration 0.2-1 ug...
Immunohistochemistry (IHC) image for anti-RHOG Antikörper (Ras Homolog Family Member G) (C-Term) (ABIN4894138) Immunohistochemistry: RhoG Antibody [NBP1-79794] - Formalin Fixed Paraffin Embedded T...