anti-Ratte (Rattus) FLT3LG Antikörper für Western Blotting

Recommended FLT3LG Antibody (geliefert von: Anmelden zum Anzeigen )

Fms-Related tyrosine Kinase 3 Ligand (FLT3LG) Antikörper
  • Flt3lg
  • Ly72L
  • FL
  • FLT3L
  • fms-related tyrosine kinase 3 ligand
  • FMS-like tyrosine kinase 3 ligand
  • FLT3LG
  • Flt3l
AA 79-110, N-Term
Human, Ratte (Rattus)
Dieser FLT3LG Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN3042394
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.2182703 ABIN1714763 IF (p) IHC (p) WB Rabbit IgG AA 70-120 Anmelden zum Anzeigen Polyclonal
1 ABIN5518989 ELISA WB Rabbit IgG AA 28-189 Anmelden zum Anzeigen Polyclonal
1 ABIN5518990 ELISA WB Rabbit IgG AA 28-189 Anmelden zum Anzeigen Polyclonal
1 ABIN1712278 IHC (p) WB HRP Rabbit IgG AA 70-120 Anmelden zum Anzeigen Polyclonal
1 ABIN1701261 IHC (p) WB Biotin Rabbit IgG AA 70-120 Anmelden zum Anzeigen Polyclonal


Antigen Fms-Related tyrosine Kinase 3 Ligand (FLT3LG) Antikörper
Epitop AA 79-110, N-Term
(15), (7), (6), (5), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (1)
Reaktivität Human, Ratte (Rattus)
(90), (19), (5), (2), (2), (1)
Wirt Kaninchen
(80), (15)
Konjugat Dieser FLT3LG Antikörper ist unkonjugiert
(11), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(73), (44), (13), (10), (6), (5), (4), (4), (4), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FLT3LG Antikörper

Target Details FLT3LG Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human,Rat.
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human,Rat.
Gene Name: fms-related tyrosine kinase 3 ligand
Protein Name: Fms-related tyrosine kinase 3 ligand
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK), different from the related mouse sequence by four amino acids.
Isotyp IgG

Target Details FLT3LG

Produktdetails anti-FLT3LG Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung FLT3LG (FLT3LG Antibody Abstract)
Hintergrund FLT3LG (FMS-Related Tyrosine Kinase 3 Ligand) also called FLT3 LIGAND, FL or FLT3L, is a protein which in humans is encoded by the FLT3LG gene. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Flt3 ligand (FL) is a hematopoietic four helical bundlecytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors. Lyman et al. (1993) found that Flt3 ligand stimulated proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow. Hannum et al. (1994) concluded that FL enhances the response of stem and primitive progenitor cells to other growth factors to generate all myeloid lineages except erythroid cells. Assays of C-terminally truncated FL proteins confirmed that the N-terminal half conferred FL activity. Depletion of the Pi3k -Mtor negative regulator Pten facilitated Flt3l-driven DC development in culture.

Synonyms: Flt 3 ligand antibody|Flt 3L antibody|Flt3 L antibody|FLT3 LG antibody|Flt3 ligand antibody|Flt3L antibody|FLT3L_HUMAN antibody|FLT3LG antibody|Fms related tyrosine kinase 3 ligand antibody|Fms-related tyrosine kinase 3 ligand antibody|SL cytokine antibody
Gen-ID 2323
UniProt P49771
Pathways RTK Signalweg


Produktdetails anti-FLT3LG Antikörper Target Details FLT3LG Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-FLT3LG Antikörper Target Details FLT3LG Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Produktdetails anti-FLT3LG Antikörper Target Details FLT3LG Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Fms-Related tyrosine Kinase 3 Ligand (FLT3LG) (AA 79-110), (N-Term) antibody (ABIN3042394) anti-Fms-Related tyrosine Kinase 3 Ligand (FLT3LG) (AA 79-110), (N-Term) antibody